FOR RESEARCH PURPOSES ONLY — This compound is not FDA approved. All data presented is from clinical trials for educational reference.

Sermorelin vial

GHRH(1-29)

Sermorelin

  • GRF(1-29)
  • GHRH(1-29)
  • hGHRH(1-29)NH₂
  • Groliberin

The 29-amino acid N-terminal fragment of GHRH — the shortest fully active sequence. Studied for stimulating the body's own growth-hormone production.

Dosage
Quantity
$149.00
View CoA
or check out in one tap
Ships in 24-48h
Free shipment protection
Overnight available
We accept Apple Pay Visa
Free shipping on orders over $150
Damage protection
Secure checkout 256-bit SSL

Certificate of Analysis

Third Party Tested by Freedom Diagnostics

Latest

99.0%

Purity

Variant Sermorelin
Lot # SAMPLE-PENDING
Labeled
Actual
Tested Pending

Compound Information

Technical specifications

Molecular Profile

What Is Sermorelin?

Type GHRH(1-29) fragment (29 aa)
CAS Number 86168-78-7
Molecular Weight 3357.9 g/mol
Amino Acids 29
Sequence YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH₂
Formula C149H246N44O42S
PubChem Database
Storage Requirements

Stability Information

  • Lyophilized — long-term stable
  • Protect from light
  • Reconstitute with bacteriostatic water
Lyophilized (powder) −20°C · stable 24+ months
Reconstituted 2–8°C · use within 30 days
Handling Avoid repeated freeze-thaw

Sources & References

Peer-reviewed research

J Clin Endocrinol Metab

Once daily subcutaneous growth hormone-releasing hormone therapy accelerates growth in growth hormone-deficient children during the first year of therapy

1996 · DOI: 10.1210/jcem.81.3.8772599

Thorner M et al.

View Source

BioDrugs

Sermorelin: a review of its use in the diagnosis and treatment of children with idiopathic growth hormone deficiency

1999 · DOI: 10.2165/00063030-199912020-00007

Prakash A, Goa KL

View Source

Lancet

Treatment of growth-hormone deficiency with growth-hormone-releasing hormone

1987

Ross RJ et al.

View Source

Clin Interv Aging

Sermorelin: a better approach to management of adult-onset growth hormone insufficiency?

2006 · DOI: 10.2147/ciia.2006.1.4.307

Walker RF

View Source

Important Research Notice

Not for human consumption. This product is sold exclusively for research and educational purposes. It is not intended to diagnose, treat, cure, or prevent any disease.

All clinical trial data and research findings presented on this page are sourced from peer-reviewed journals and official publications. They are provided for educational reference only and should not be interpreted as medical advice or product claims.

By purchasing this product, you confirm that you are a qualified researcher and will use it in accordance with all applicable laws and regulations.

All the research peptides you need, with the peace of mind and research community at your fingertips.

Shop Now

Research updates from SFSC

Subscribe for catalog updates, new research compounds, and quality documentation news

For researchers and labs. No spam, unsubscribe anytime.

Subscribed — coming soon!

Scroll to Top