FOR RESEARCH PURPOSES ONLY — This compound is not FDA approved. All data presented is from clinical trials for educational reference.

LL-37 vial

Antimicrobial Peptide

LL-37

  • Cathelicidin (CAMP)
  • hCAP-18(134-170)
  • CAP-18 C-terminal peptide

The only human cathelicidin antimicrobial peptide — a 37-residue C-terminal fragment of hCAP-18. Studied for broad antimicrobial defense, immune modulation, and wound healing.

Dosage
Quantity
$179.00
View CoA
or check out in one tap
Ships in 24-48h
Free shipment protection
Overnight available
We accept Apple Pay Visa
Free shipping on orders over $150
Damage protection
Secure checkout 256-bit SSL

Certificate of Analysis

Third Party Tested by Freedom Diagnostics

Latest

99.0%

Purity

Variant LL-37
Lot # SAMPLE-PENDING
Labeled —
Actual —
Tested Pending

Frequently Researched Together

Commonly studied alongside other recovery & repair compounds

Compound Information

Technical specifications

Molecular Profile

What Is LL-37?

Type Cathelicidin antimicrobial peptide
CAS Number 154947-66-7
Molecular Weight 4493.3 g/mol
Amino Acids 37
Sequence [LL-37, 37 aa]
Formula C205H340N60O53
PubChem Database
Storage Requirements

Stability Information

  • Lyophilized — long-term stable
  • Protect from light
  • Reconstitute with bacteriostatic water
Lyophilized (powder) −20°C · stable 24+ months
Reconstituted 2–8°C · use within 30 days
Handling Avoid repeated freeze-thaw

Sources & References

Peer-reviewed research

Proc Natl Acad Sci USA

The peptide antibiotic LL-37/hCAP-18 is expressed in epithelia of the human lung where it has broad antimicrobial activity at the airway surface

1998

Bals R et al.

View Source

J Exp Med

LL-37, the neutrophil granule- and epithelial cell-derived cathelicidin, utilizes FPRL1 as a receptor to chemoattract human peripheral blood neutrophils, monocytes, and T cells

2000 · DOI: 10.1084/jem.192.7.1069

De Yang et al.

View Source

Infect Immun

Human CAP18: a novel antimicrobial lipopolysaccharide-binding protein

1995 · DOI: 10.1128/iai.63.4.1291-1297.1995

Larrick JW et al.

View Source

Important Research Notice

Not for human consumption. This product is sold exclusively for research and educational purposes. It is not intended to diagnose, treat, cure, or prevent any disease.

All clinical trial data and research findings presented on this page are sourced from peer-reviewed journals and official publications. They are provided for educational reference only and should not be interpreted as medical advice or product claims.

By purchasing this product, you confirm that you are a qualified researcher and will use it in accordance with all applicable laws and regulations.

All the research peptides you need, with the peace of mind and research community at your fingertips.

Shop Now

Research updates from SFSC

Subscribe for catalog updates, new research compounds, and quality documentation news

For researchers and labs. No spam, unsubscribe anytime.

Subscribed — coming soon!

Scroll to Top